DPCstruct | MC38486
Metacluster Properties and Pfam Annotations
| Number of structural domains | 83 |
|---|---|
| Mean domain length (aa) | 181 ± 19 aa |
| Standard deviation of domain lengths | 19.28 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 93.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 38.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00920 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C5KAF0 | 1-186 | LISVFQGVGKLQAGQITEADLAKLEQSACPTCGSCAGMFTANSMNCLCEALGMALPGNGTILAVSKEREALYLRAARAILQLIAKDI… |
| W7PN11 | 1-143 | MNSMAEALGMSLPGSAVIPAPYKERAMVAFETGTRIVEMVWENLRPLDILTREAFENAIVTCSGLGGSSNAPVHINAIARHAGVELT… |
| A0A840NW28 | 40-229 | None |
| A0A066VG21 | 189-361 | None |
| A0A1V5ZGU5 | 56-242 | None |
| A0A378AA27 | 66-248 | None |
| A0A7S4E837 | 228-412 | None |
| R9P8I1 | 396-577 | None |
| H0ESC2 | 66-264 | None |
| A0A1P8WEJ7 | 166-348 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.