DPCstruct | MC38484
Metacluster Properties and Pfam Annotations
| Number of structural domains | 81 |
|---|---|
| Mean domain length (aa) | 73 ± 14 aa |
| Standard deviation of domain lengths | 14.47 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 85.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 54.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0172 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V1WY15 | 41-103 | EKKVKYNRLINQSSPYLLQHATNPVDWYPWGKEAFEKAKKENKPTFLSIGYSTCHWCHVMEQS |
| A0A117SU45 | 8-91 | CLKATKSPFVLEGLHSPVKWWGWCREAFEAARALDRPVLVDVGAVWCHWCHVMDETTYSDPEVASFINEHFVAVKVDRDERPDV |
| A0A411PE43 | 67-153 | None |
| A0A2N2KGJ4 | 4-84 | None |
| A0A3N5WHY6 | 2-70 | None |
| A0A314ZZ54 | 1-59 | None |
| A0A034VIF4 | 88-169 | None |
| B4DZC5 | 50-134 | None |
| A0A257MPC6 | 21-83 | None |
| A0A4Q2LMN3 | 1-65 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.