DPCstruct | MC38483
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 218 ± 37 aa |
| Standard deviation of domain lengths | 36.58 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 92.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 29.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0124 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W9T9A2 | 350-563 | AKKHDFENKLKAKVKADEKLNKKYGHVWDEIGSVIDKIKTDPRNNKLHKSLEVLNQKLGRLIYEVYSSQIPPDATSTLRISDGVIKD… |
| A0A380CST5 | 234-474 | QNLKFSNQEQAGKYAIQLIKESKLNKEATLNKDILANAKSLLTYSDNLLIFQKSLDQELTTFGKEQQRRDGQLNKLMGDYVAVKEIY… |
| A0A1G0LAI3 | 288-507 | None |
| A0A812Q9R4 | 879-1125 | None |
| A0A3G8M0L0 | 480-724 | None |
| A0A349VHX3 | 38-245 | None |
| A0A812Q337 | 6-203 | None |
| A0A2T2UJK3 | 35-261 | None |
| I9SX77 | 12-216 | None |
| A0A7V1MHE0 | 224-453 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.