DPCstruct | MC38479
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 174 ± 22 aa |
| Standard deviation of domain lengths | 21.68 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 28.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W9SNH7 | 1-205 | MSLNKNHIELITKAIIESETIDKDLQDDLLDHYCCTIEHDMKKGAKFDDAFSKAFKSMNPTALKGNQDMTLYLLNSKKNKSSIQILW… |
| A0A5E7ZTH1 | 1-159 | MGSLSKEQLQAIRDYLARQGMTYKPLQDEMLDHVCCDIEKLLASGQPFDAAWLAITTEIPPKQIQTIQLETMETMNKRESLSKWFAY… |
| A0A7V4GV78 | 1-170 | None |
| A0A2G2F1S2 | 1-171 | None |
| A0A1Z5SGA9 | 1-166 | None |
| A0A524GUQ4 | 3-199 | None |
| A0A3N6A4I7 | 5-197 | None |
| A9DUN4 | 1-138 | None |
| A0A0S8HTU0 | 1-145 | None |
| A0A6C1RZY9 | 16-209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.