DPCstruct | MC38473
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 106 ± 20 aa |
| Standard deviation of domain lengths | 19.98 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 83.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 52.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5U2F487 | 77-215 | SQWKPDVCPVTGRKFFMWIEHETLGYVPTYGGPFDSYTIPTRDSSGEFSCERYDHDFGGWVGGEFIGLHLIDDEEQCRVCELEERIA… |
| A0A839A3B4 | 5-130 | MSNPWCPDVCPITSEPFFMWIEHHATGQSVPTYGGPYDSYTIPEKDQNGSYYRERYDHDEGCWRLDDVEDVGVQIVSDQAYISDDTP… |
| A0A0E0XZF7 | 136-224 | None |
| A0A1B7JZE7 | 83-170 | None |
| A0A6S5THQ1 | 3-109 | None |
| A8GLN7 | 70-177 | None |
| E3HGM4 | 114-227 | None |
| A0A564U8W6 | 1-74 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.