DPCstruct | MC3847
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 136 ± 11 aa |
| Standard deviation of domain lengths | 11.25 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 92.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 49.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0617 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3T1DZS7 | 49-190 | MTDADMAMKMDPTYRAICEKFMADPEYFKQTFAKAWFKLTHRDLGPKSRYIGPEVPAEDLIWQDPIPAGSTDYSEEVVKQKIAEAGL… |
| A0A2U3LYU3 | 1-127 | MMTTADLSLRLDPIYEPIARRYQQNPAEFTDAFARRWFKLTHRDMGPRSRYLSPEVPAEDLIWQDPMPAVDYVLSDELDNANLKGEI… |
| A0A4U9CSL9 | 1-129 | None |
| A0A7K1AMW2 | 195-351 | None |
| A6TV07 | 56-193 | None |
| A0A3R7DKX3 | 128-269 | None |
| A0A3S4FBP2 | 160-312 | None |
| D7G523 | 355-500 | None |
| A0A377BPP4 | 1-112 | None |
| A0A1D3RPC2 | 155-279 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.