DPCstruct | MC38461
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 58 ± 6 aa |
| Standard deviation of domain lengths | 6.01 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 85.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7T8QUH5 | 1-47 | MSSELERRTAIIVALRCGRAPKEIIDFFKFPKATVYSIAKSFKESED |
| A0A7T8KIS1 | 1-61 | MSSELERRTAIIVALRCGRAPKEIIDFFKFPKATVYSIAKSFKESEIRGRIPNTGKKDSRP |
| A0A7T8KK36 | 1-51 | None |
| A0A7T8QVK2 | 1-61 | None |
| A0A7T8QUI2 | 1-58 | None |
| A0A7T8GTL1 | 1-61 | None |
| A0A7T8K979 | 1-60 | None |
| A0A7T8GYJ9 | 1-63 | None |
| A0A7T8GQU9 | 1-68 | None |
| A0A7T8KF62 | 1-52 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.