DPCstruct | MC3846
Metacluster Properties and Pfam Annotations
| Number of structural domains | 91 |
|---|---|
| Mean domain length (aa) | 80 ± 15 aa |
| Standard deviation of domain lengths | 14.97 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 76.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0758 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U3LVZ1 | 14-84 | NGKEGEDMKEKIHPIYEQTTVTCACGEIILTASTRKDIKVEICSKCHPFYTGVQRFVDVGGRVDRFKKKYG |
| A0A4P7N0L5 | 45-124 | SQQVRHATLIHRPRRPYTFTQMVQLSDGSTYTVRTTSPHAIYRSAKDTRNNARWQPSDSSLRNVEMDEAGKLAAFRERFG |
| A0A3B0RXZ8 | 51-133 | None |
| A0A3M0XP74 | 1-71 | None |
| A0A5B8ML13 | 21-105 | None |
| A0A1F7VCB4 | 1-71 | None |
| A0A7Z0FY77 | 78-166 | None |
| A0A378F8S4 | 1-81 | None |
| A0A1A9X909 | 313-385 | None |
| A0A0S7X3C9 | 1-57 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.