DPCstruct | MC38457
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 129 ± 18 aa |
| Standard deviation of domain lengths | 18.16 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 74.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 47.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y2AXI4 | 31-132 | QHCIVKLEALYNEWRMLQKHSKRKSETQEQKEQNFKQKLEDLLDIAHSNALIIITIEEDRQFLISQRQKGRIGVLRGIDKRTDEKEK… |
| A0A7T8JZ28 | 1-150 | MIIEVWSNARIPFQRKGNIMRKIEKLHKMFLNVKRNKGRAGSQAAREDAFRKKIKNLFDVATSNALDALDNEEDKAFLLAQRERGRR… |
| A0A4Y2VV61 | 9-101 | None |
| A0A4Y2JAF1 | 2-120 | None |
| A0A6G0Y9T6 | 57-198 | None |
| A0A4Y2S5P7 | 1-133 | None |
| A0A4Y2WZD6 | 14-145 | None |
| A0A6G0TTW6 | 55-196 | None |
| A0A4Y2PUY8 | 1-129 | None |
| A0A4Y2LGC5 | 2-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.