DPCstruct | MC38450
Metacluster Properties and Pfam Annotations
| Number of structural domains | 71 |
|---|---|
| Mean domain length (aa) | 416 ± 75 aa |
| Standard deviation of domain lengths | 74.99 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 80.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 16.71 |
| Pfam Score | 98.81 |
| Assigned Pfam label(s) | PF08385- CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J3BT46 | 105-529 | INTWPDSVKSEFCSHIHTFLAKLTDMYYKMLGLTVLYIPREGQQLSFEAASADRELVKRLEGVVVYWTHQIKSCIEDQAFVASQKEL… |
| A0A834QAS8 | 4-451 | WTRQIKEVLSSQETVETGENSGPLEEIEFWRNRCMDLSGISKQLVKPGVKHIESILRLAKSSYLTPFIKLAQQIQDGSRQAQSNLTF… |
| A0A0C9WUN4 | 43-558 | None |
| S4RY57 | 83-523 | None |
| A0A7R9DX96 | 236-653 | None |
| A0A1Q9D1I6 | 553-880 | None |
| A0A7G2C6L8 | 242-680 | None |
| A0A6G0HIP5 | 261-686 | None |
| A0A452J4J6 | 21-380 | None |
| A0A7R9CPJ3 | 177-734 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.