DPCstruct | MC3845
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 73 ± 9 aa |
| Standard deviation of domain lengths | 8.84 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 35.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W9IB94 | 1-85 | MLEHLIRSLTIRDVFASPSLRWADPRAHLLAGAQWEAIAQDVLASLSLTDPVQKHLNDKVLALDAAWKQMAARLEEAARTRWSRW |
| A0A773MHJ4 | 32-105 | LERLQDALRRRDIWLENSDRWGNPREKLLQGEEWQAQRVPVCRALGHPTDGHKGVQQLAVQLDETWKTVASRFE |
| A0A7W1LY68 | 250-320 | None |
| A0A378Y977 | 2-63 | None |
| I6D9R5 | 15-79 | None |
| A0A544XQU4 | 3-68 | None |
| A0A2N3YUI4 | 469-524 | None |
| A0A100IZK9 | 1-76 | None |
| A0A844VV25 | 124-210 | None |
| A0A535FC84 | 34-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.