DPCstruct | MC38449
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 252 ± 54 aa |
| Standard deviation of domain lengths | 53.72 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 83.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 34.74 |
| Pfam Score | 96.43 |
| Assigned Pfam label(s) | CL0020- PF20422 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834Q0S0 | 6-223 | FHLQLWNNYFHLAVAFITQDSLQLEQFSHTKYNKILNKYGDMRRLIGFSIRDMWYKLGQNKICFIPGMVGPILEMTLIPEAELRKAT… |
| A0A4Z2HKL1 | 42-261 | FDYKVWDSYFYLSVIFINQPCLQLESFSPSKRKKTLEKYGDMRVMMGCEIFSMWQNLGEHKLNFIPAMIGPFLEVTLVPQPDLRNVM… |
| A0A183H9Y4 | 264-487 | None |
| G1PY53 | 775-1057 | None |
| A0A3Q0KDW4 | 1336-1614 | None |
| A0A7R8H2G2 | 139-447 | None |
| A0A5E4PVU9 | 658-870 | None |
| A0A821RRP8 | 918-1128 | None |
| A0A4W3GEW9 | 382-702 | None |
| S9WYG2 | 174-473 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.