DPCstruct | MC3844
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 185 ± 43 aa |
| Standard deviation of domain lengths | 42.82 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 85.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 22.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U3L1R9 | 14-174 | LLQMLTEYPELSRTDLRNECPKEYSFLYRHDREWLFEMLPTGKPQTGSKGYVDWNQRDHEVLSQLQKAQMDLLNREKPIRISKTSLG… |
| E6PKG4 | 2-112 | WPEIDRDWVTELNAWVDIVGKESPPVRITVAELERRANRRDWLLKRRHHLPLTMEFLDQAVETVEQFQLRRIHWAIAELELCGAPVK… |
| A0A838ZVI4 | 118-361 | None |
| A0A7K0GPL9 | 26-243 | None |
| A0A5B0VXF4 | 27-134 | None |
| A0A7Y5B2B6 | 137-338 | None |
| A0A0P9TYW5 | 87-246 | None |
| A0A5D4SYI6 | 1-127 | None |
| A0A7W8K9K8 | 2-145 | None |
| F8XX78 | 976-1154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.