DPCstruct | MC38434
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 88 ± 11 aa |
| Standard deviation of domain lengths | 10.81 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 29.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19668 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C7P5C2 | 36-114 | PEPTLVEKAKNFTKAVTKHVIKGFRNVPEDVQKARYDTCKGCEHYNPEKDSCRLCGCKMSVKTGWSEQECPINLWTAWS |
| A0A4P5WTH7 | 382-460 | PALPGKVKMAANFTKSLAAHVADGLQKVEAPELQRRLEVCTLCDQRNDDRCSVCGCYLAEKASWRSSECPLGKWNQKQE |
| A0A2J6JCF7 | 32-102 | None |
| A0A517Y7N1 | 1-84 | None |
| A0A6M0EP50 | 1-105 | None |
| A0A1G2YR60 | 80-159 | None |
| A0A352KUJ5 | 14-107 | None |
| A0A2E4WMU9 | 1-95 | None |
| A0A329ZX11 | 207-288 | None |
| A0A5C6AD74 | 354-436 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.