DPCstruct | MC38430
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 137 ± 31 aa |
| Standard deviation of domain lengths | 30.68 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 85.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 23.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14239 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D6XSK7 | 2-130 | TKNTRIEHSLEKSHAVDARCISGHPTAKPSEATYQYKQVRKNNRQLHKTTILKGGIRKANKAERFVKGFQLFDKVLCEGQPCFIFGR… |
| A0A6B3MZI9 | 32-179 | LYYELKSIGLPVEVGSGGLTKFNRCRQNLPKTHWLDAANVGKVETLIIEVTLPLVITAKGHGTRQLCRTNKYGFPIRHCSRIKFHKG… |
| A0A2H9L3Z1 | 14-159 | None |
| A0A7R9N8L1 | 371-521 | None |
| A0A412KNI7 | 6-139 | None |
| A0A0P9E2G0 | 248-417 | None |
| A0A496AXD4 | 329-512 | None |
| A0A368TX28 | 82-228 | None |
| A0A0K2WCN3 | 145-294 | None |
| A0A1Q6RQF9 | 4-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.