DPCstruct | MC3843
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 179 ± 19 aa |
| Standard deviation of domain lengths | 19.36 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00590 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A077P2W6 | 192-357 | PQHDVYLYVAPSIAIAKPLVEKYKIADFRKPEVVKRVTGISTFYLPPKTIREPDPAVGKLLGLKVLANAGYADPCTPGKPYGERELA… |
| A0A0W0FLM8 | 7-214 | KFSILVDRLEKDFGPNHTVVHYVGRVLPQAVSKIETFTVGDLRKVEVQRHFDAVSTLYVPPRDMSPVDPGMASKLGPVGVRTDVIEA… |
| A0A1B7MIP1 | 107-304 | None |
| A0A0X3UXQ3 | 25-181 | None |
| A0A3N8G071 | 367-546 | None |
| A0A255YTD0 | 146-333 | None |
| A0A7D9LYK7 | 108-288 | None |
| A0A1B7N203 | 64-263 | None |
| A0A1B7MWY8 | 18-166 | None |
| A0A1B7MSR9 | 1-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.