DPCstruct | MC38428
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 118 ± 17 aa |
| Standard deviation of domain lengths | 16.61 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 31.55 |
| Pfam Score | 97.73 |
| Assigned Pfam label(s) | CL0369- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A6CKG2 | 64-177 | FPLLFFLVQIQKVFSTPCAQRFYPSLFETRIVCVCNATFCDEYEDTPLTTGTAQIFSSSERGDRMNSRSAPVLNGYQGSWLSARISV… |
| A0A6J1WA84 | 2-96 | VCVCNATYCDTVDPVSLPDVGYYVKYTTSRDGQRLERSEGQTDATSGASGGIFYTYNPFVQYQYIKGFGGAFTDAAAINILKLSYAT… |
| B7Z7D8 | 19-112 | None |
| A0A7R9KDF6 | 9-123 | None |
| A0A232FLD1 | 37-149 | None |
| A0A7R9L1Y2 | 1-110 | None |
| A0A6V7WDE2 | 28-142 | None |
| A0A6V7WNB7 | 48-148 | None |
| T1KQI0 | 5-117 | None |
| A0A7R9AUX7 | 38-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.