DPCstruct | MC38423
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 187 ± 18 aa |
| Standard deviation of domain lengths | 18.49 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 29.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S7U4U7 | 1-187 | MSDLLPKGIYENLLTSELQRRLDNLDAKNHIARISEIDPSLAGDFLTRSLSEHIQRALKTLGKGKDSKNIYLLANRILQTIGEYDDS… |
| A0A6J7P452 | 3-184 | GELPEGLYEALVTRGLEKKLAEIDPRVIDKRLVHRAEVPDRFALHLARAIEKSLRSVPDADRVSVGLGVLESVLDVLAGLSASDVVD… |
| A0A239YEJ2 | 1-176 | None |
| A0A1M6GRN7 | 1-232 | None |
| G2FP28 | 2-166 | None |
| A0A558BD63 | 3-187 | None |
| Q1NV91 | 64-233 | None |
| A0A1V0N3S8 | 5-202 | None |
| A0A4V1FCH7 | 1-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.