DPCstruct | MC3842
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 103 ± 13 aa |
| Standard deviation of domain lengths | 13.33 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 41.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0W0FKT7 | 4-106 | HENKPREDNAFQRDRVEMSRTLMYEKGYSVDNQTVNELLSKWSGLPHRNPFSKLLSMIDDNYYKLFCNDLMHEAAGRWNDVFKHLCR… |
| A0A4S4KAA6 | 177-287 | MGTKTDMKRREKNARVDDKERRRVINMTRTWIYEKGLPLTSKYLDQVLTSRSWVPVRNAFSTKLSKFGMDFHSMLTVDLLHEFELGV… |
| A0A0C3N5N6 | 45-141 | None |
| A0A401GTH2 | 2-75 | None |
| A0A4Y7T3C5 | 559-650 | None |
| A0A4Q2DL43 | 1-105 | None |
| A0A369J6X6 | 1-94 | None |
| A0A369J8U2 | 363-466 | None |
| F8NJM3 | 16-101 | None |
| A0A0D0D1P6 | 2-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.