DPCstruct | MC38415
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 177 ± 24 aa |
| Standard deviation of domain lengths | 24.09 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 92.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 38.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J2TKS3 | 173-350 | EIADYILNRVGAVGFSWGPYSHKAASIATGFNRLGVPVVVGPHAMKYRRAYIGKPWKKDKWWVYDIKSGQKVFIEPAPDSLLVAVET… |
| A0A842TG29 | 2-175 | EIADYILNRVGAVGISWGAMSQKAASIATGFNAMGVPAIVGPHGSKYRRQYLGKDYDDEAWKVIDSRTGDIVTYGPGPENLMMACET… |
| A0A843BUL7 | 1-126 | None |
| A0A1F9ITR2 | 459-624 | None |
| D9PXR1 | 6-138 | None |
| A0A1V5B7L8 | 75-267 | None |
| A0A7C1PMR9 | 441-616 | None |
| A0A7C0X3N7 | 37-212 | None |
| A0A7C2W742 | 358-563 | None |
| A0A7C2W6Y7 | 144-360 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.