DPCstruct | MC38413
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 63 ± 5 aa |
| Standard deviation of domain lengths | 4.86 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 92.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 51.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A535AZL7 | 59-122 | KDRLKGGLADGKAITEYDLEELLTGIKFEMEHTSDGFIALEIAMDHLERIPDYYSRLCRLEREA |
| A0A842TAE0 | 11-72 | NRLRGGLADKNCPEDFDPKQLEMGIKVEMEHTSDPEIAKEIAMDHLKEHPRYYDYLEEMEGE |
| A0A524Q7Q3 | 4-61 | None |
| A0A0F9SGB5 | 16-72 | None |
| A0A7C3JI13 | 63-129 | None |
| A0A150ITD4 | 55-124 | None |
| A0A0F9M4Q1 | 6-74 | None |
| A0A5C7LLJ0 | 25-82 | None |
| A0A831P9S8 | 54-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.