DPCstruct | MC3841
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 193 ± 17 aa |
| Standard deviation of domain lengths | 17.39 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 39.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0W0FI18 | 37-228 | SGSIRVSKSNRSLSLIQLYQDYFCFFILFPIVSKLWVHPSFKIQQESLSLIQLYQDSWSAYPGPEEGDEQLAFIAALIKPLKQDHYS… |
| V2XQR4 | 93-265 | TSFLISSINSRQAELQSLVNLRFVIPFTTLAKLWTHDDPDDQEQSSQLLPFLEDAFSTHPGYNEERHDRERLAFISALANHLNDTDF… |
| V2X039 | 139-338 | None |
| E2LRT8 | 1-195 | None |
| E2LGP0 | 76-258 | None |
| V2X481 | 87-293 | None |
| V2WL22 | 1-221 | None |
| A0A0W0GDJ7 | 202-372 | None |
| A0A0W0FX53 | 114-324 | None |
| A0A0W0FPD6 | 57-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.