DPCstruct | MC38403
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 182 ± 25 aa |
| Standard deviation of domain lengths | 25.08 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 75.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 19.23 |
| Pfam Score | 77.78 |
| Assigned Pfam label(s) | CL0020- CL0741 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A368GGN3 | 42-219 | KVYMGKHMIERQCGLCGHFDEEKDNEFLTPRREYTDDIMEFHKSYLLNDECEVEKEFINEKKHYKVEEDYERKEDFVDIFEEDTRKE… |
| A0A7D9I465 | 525-719 | TVKVNGVKVEIKPGMNVVPGGKVAMINNQVYFQADAGFQCLFDGSMTIVLFSPWYHNRIQGICGNNDGEQWTDFGTRRKTFMPETMT… |
| A0A444SBK4 | 948-1123 | None |
| A0A6H5H3N9 | 653-828 | None |
| A0A2H2IZF9 | 1009-1172 | None |
| A0A2A2KL47 | 1-191 | None |
| T1L5P9 | 592-807 | None |
| A0A5N5TIJ5 | 5-155 | None |
| A0A0P6CYT5 | 408-596 | None |
| A0A553PSI1 | 216-362 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.