DPCstruct | MC38402
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 93 ± 6 aa |
| Standard deviation of domain lengths | 5.95 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 77.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 52.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A368GFH8 | 1-87 | MTEEGEHSRSPDECAQAGLWEVEPLYYSIPGRSDRSRRGKAYRKRADGEICCFEAHDGIVYKPGDSVYIEATPSDPYIVGSITMFKM |
| A0A0N4UDR8 | 1-105 | MDEDELGDLTPEECQNRGICEVDPVYYSLNGNNKGDYPRNKRGKAYRLRTSGSYVFFEAHDGVMYKPGDFVFIELSQCEPYGVGLIT… |
| A0A4U8UKZ5 | 4-97 | None |
| A0A158QZR3 | 1-88 | None |
| A0A0D8XGD2 | 1-88 | None |
| A0A7E4VYT8 | 19-115 | None |
| A0A0R3Q5Q3 | 1-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.