DPCstruct | MC3840
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 147 ± 8 aa |
| Standard deviation of domain lengths | 8.10 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 71.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 33.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S4LZ25 | 1-132 | MPDTNLDPNSPELFKENIKVAQAHLRHVQSLARDALDGIERAYQAHTNPTQTVASLATLKQSLHDLSELLRITGVGALPLLASDVTE… |
| A0A0W0FH13 | 20-182 | MGPSPMNSSLPGLQTGQSIANDPNSVDTFKQNIQMILENVIRIQGVASSALAGIKNAYYLGSSSAQTQADLATLQQNLHILSDMMRH… |
| A0A5N5QSJ5 | 54-205 | None |
| A0A0C9Y498 | 38-183 | None |
| J4GER8 | 31-177 | None |
| A0A4Y9YE15 | 80-225 | None |
| A0A2A9NBN8 | 2-147 | None |
| A0A1B7N0V2 | 2-137 | None |
| A0A164NX71 | 85-224 | None |
| A0A0L6WGR1 | 24-176 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.