DPCstruct | MC384
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 98 ± 3 aa |
| Standard deviation of domain lengths | 2.95 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 72.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 42.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A844MWI7 | 1-100 | MPDNQNQPKEFDAILGGQAPPPVESAVLGGLQGVKYRLTSPIVEVRIAALSEALNYGEAGLDVAIDALQDTAEQVRRSASRLLRQNG… |
| A3ITC4 | 1-100 | MNDQSKQPQPSDLVLGGNNPSPTDGLVLGGIEGVKKRLASDDVKVRIAALSDAIKYGDEGLDLVIKALEDESDRVRINAYLILRSRK… |
| A0A7Y0IR91 | 1-103 | None |
| A0A3C0NKH8 | 3-95 | None |
| A0A1Z4UJC5 | 1-103 | None |
| A0A433UPW9 | 1-98 | None |
| A0A3S1D5H3 | 1-101 | None |
| A0A563VVA1 | 1-103 | None |
| A0A7Y0IRL7 | 1-95 | None |
| A0A351LD70 | 1-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.