DPCstruct | MC38395
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 111 ± 7 aa |
| Standard deviation of domain lengths | 7.49 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 45.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13660 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A368G5G0 | 1-121 | MLAVPNLRSRVFHGARNNLPDSDSVAATLEALKSIERNDSSDSIFLFLVSGGGSALFCAPDGISLEEKLMTIRTLAANGADIRVLNS… |
| A0A7R9CE40 | 105-208 | KQGSVLQFIEGAKNNLPDKSSLGAAIKIKDLVKSLDQNAILLVLISGGGSSLLPLPQTPVTLNEKCRVINLLASSGANIMELNCVRK… |
| A0A6L5D8K4 | 152-247 | None |
| A0A814D4Q3 | 708-826 | None |
| A0A177GES8 | 90-207 | None |
| U4UMQ4 | 125-240 | None |
| A0A1A9V4C5 | 118-228 | None |
| A0A0L7QNQ2 | 91-193 | None |
| A0A182SMT7 | 96-214 | None |
| V9II50 | 105-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.