DPCstruct | MC38394
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 114 ± 15 aa |
| Standard deviation of domain lengths | 14.58 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 70.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 43.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01699 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A368G134 | 2-123 | VRLGAWLLAAILVATLDSTVATNCSAADATRNCIDGLIVPIWRPFLDLSPGDKIMRGVIYFLVIAYCFLGVSIVADRFMSSIEVITS… |
| A0A0C2FML1 | 2-83 | RGFIYFLVIAYCFLGVSIVADRFMSSIEVITSMERKIIVKRPGLDPMEVNVRIWNDTVSNLTLMALGSSAPEILLSIIEIIA |
| A0A6J8DZN7 | 18-123 | None |
| A0A813FHA2 | 169-284 | None |
| A0A1Q9EP80 | 27-154 | None |
| A0A2A6C0Y6 | 10-128 | None |
| A0A1I8IKI8 | 23-124 | None |
| A0A7I4D7L8 | 19-135 | None |
| A0A3B5AMT3 | 19-134 | None |
| J9AT00 | 34-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.