DPCstruct | MC38392
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 138 ± 11 aa |
| Standard deviation of domain lengths | 11.45 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 38.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18151 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A368FS64 | 1-149 | MREEYRKRSSYLLYLQQSRITLLRLSTYVDKLIQRIQRDKALVEECLVEVLVRFYMENKDQQLKRFLQEFVILNAQDEKTDCLLRTL… |
| A0A6J1PIJ8 | 7-130 | REDYQKRYLYIAYLIRCRQGLLSTLAHLDRLCVRVKCDRDAINNHLVSVCVRVFLEKKKAFLLCFCEEFKKLTLADEKQDLVDNFLG… |
| A0A183U3L9 | 143-287 | None |
| V3ZNM9 | 65-193 | None |
| A0A6J1W510 | 95-231 | None |
| A0A085LKL7 | 63-211 | None |
| A0A2H8TX75 | 3-124 | None |
| A0A016WVA2 | 326-465 | None |
| A0A814C2P2 | 228-354 | None |
| A0A085NDX0 | 80-239 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.