DPCstruct | MC38390
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 116 ± 16 aa |
| Standard deviation of domain lengths | 16.10 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 45.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M1DT81 | 1-123 | MLVEPEAIEKHVQIEEILKAEPSLPRIEIVEKCCGPQNCSHVFGFGGGVKAKDMRDGTSSNAELLSELRSTQEKNKSLNEENKSLHD… |
| A0A6V7QCB8 | 101-207 | QLEGEDTIKKYDEILVASQSNPTFSNIELIEKCFGSQCRNHVVCFGGGVKSTDLKPSSSSRAELHAKLCETHKENESLKSRIDGMEV… |
| M1DDC7 | 39-177 | None |
| A0A6V7PSR6 | 54-182 | None |
| M1A2T7 | 3-98 | None |
| M1DWL3 | 232-361 | None |
| M1DVP9 | 1-146 | None |
| A0A1J6KYF6 | 32-145 | None |
| A0A314L5U2 | 14-112 | None |
| A0A2G2ZNP5 | 6-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.