DPCstruct | MC3839
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 134 ± 13 aa |
| Standard deviation of domain lengths | 13.32 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 36.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y7Q925 | 2-116 | DVPAAIAALLDSTRRLQSSLRQWSLLQISETEVSDVYVKVCTDFHIAVAALSSYNIDMSDVMSFPQAMRDILEGCLAEDASPQVLEA… |
| A0A0W0FAB6 | 19-130 | RREVESSVTRFLVSIKQLLRVLSEWSHLKVDENGVSDVYVQTINDFHTSVMAFAMLEINMSELESVPEDLRHVLEECLSEEASVPAL… |
| A0A1C7LNS8 | 491-623 | None |
| A0A1X2GKT0 | 12-122 | None |
| A0A4V3XFK6 | 3-143 | None |
| A0A367J9D9 | 2-117 | None |
| A0A2A9NYV3 | 29-167 | None |
| M5GBW3 | 15-165 | None |
| A0A427YHM9 | 29-168 | None |
| A0A2R6NEM0 | 106-256 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.