DPCstruct | MC38382
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 47 ± 5 aa |
| Standard deviation of domain lengths | 5.00 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 70.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 88.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D6F0E3 | 1-51 | MSDSEEHHFESKADAGASKTYPQQAGTVRKNGFIVIKNRPCKVVEVSTSKT |
| A0A7J0EPS8 | 1-57 | MSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKNRPCKVRVSLTRSQSLSKFVV |
| A0A843UV42 | 1-43 | None |
| A0A4S8IY09 | 1-51 | None |
| A0A426WZZ6 | 107-148 | None |
| A0A7J7HUB1 | 1-42 | None |
| A0A453K387 | 1-42 | None |
| A0A7J0DB82 | 1-46 | None |
| A0A6V7Q9V3 | 1-48 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.