DPCstruct | MC38381
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 72 ± 6 aa |
| Standard deviation of domain lengths | 5.64 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 46.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0247 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J0EKX4 | 1-73 | MEVEAPKCMYLVWAIPPEDVRERLKRLMSGLRSEFDGPKFEPHITVVGAISLTEEDALDFLLSVRFSASQSNS |
| A0A803MVD2 | 1-61 | METQPHAYSVWAIPPEHVKKRLKKLMDTLRSEFGGPELVPHLTVVRAVTLTPEDALEKFRL |
| A0A7J6WC92 | 80-157 | None |
| A0A452ZK66 | 23-99 | None |
| A0A816R5E1 | 284-360 | None |
| Q0DGQ4 | 2-71 | None |
| A0A061GEN8 | 147-223 | None |
| A0A6J5XP42 | 34-101 | None |
| M5WPL8 | 1-76 | None |
| A0A5E4FE85 | 9-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.