DPCstruct | MC3838
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 242 ± 34 aa |
| Standard deviation of domain lengths | 34.04 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 34.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0W0F8L6 | 56-282 | GTGRTKSTTIYGSTSSMTSYGRGGGPVSTVPEGQKFAGRSVGGGDRSSIYGSRTYGSGYPSQSSTSVQGRGFPYYFWPLTFIAGVAA… |
| A0A4S4L1K8 | 65-329 | SAFSLSSSGLGKTTASAYSDGGGKPSTLGSSSPFSGRLTGGGGRSGVYGTFRFGSGYPYGGYGQYVDSRPFPYGFYPVPVAVGYYGG… |
| G4T9W7 | 33-356 | None |
| G4TUX3 | 5-244 | None |
| G4TYY8 | 53-293 | None |
| A0A0H2R906 | 155-423 | None |
| A0A5N5QF37 | 99-384 | None |
| B0DDI2 | 287-518 | None |
| A0A4S8LMA6 | 3-222 | None |
| A0A5N5QM12 | 88-326 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.