DPCstruct | MC38374
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 398 ± 81 aa |
| Standard deviation of domain lengths | 80.81 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 82.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 19.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10408 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A544ZUH3 | 8-355 | ASNPDHDTIAPYLLKGVNDESGICFEFIQEAIKRFDDDEAFPAIFNDAMIRLSGQLNQMSMGDNYKPYVQALMVYSRFPILISNLAQ… |
| A0A4P9YWJ9 | 35-470 | QRRPEYTLLAALQAELQEEPDMPKPPTIQLAILDRVLVARLSMPPEELAPGTPTILFDYLLACWHRCAEIATGLRQRAKTFTPDVLE… |
| A0A086J8S4 | 2-373 | None |
| A0A368FFY0 | 33-506 | None |
| A0A0D2MDQ3 | 19-459 | None |
| K2SY82 | 7-336 | None |
| A0A1B7N6D4 | 119-551 | None |
| A0A0R3TAA4 | 24-517 | None |
| A0A485NF66 | 2-410 | None |
| A0A7J7IDE7 | 40-477 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.