DPCstruct | MC38373
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 112 ± 19 aa |
| Standard deviation of domain lengths | 19.31 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 36.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03676 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287XAZ7 | 110-246 | LRLIEIFDVKRLQLRYATSLIGGPSTLATFVSVYALFGPTFPGIYDKERGMYTLFYPGLSFAFPIPSQYTNFFNNGEVADLPLEFPD… |
| A0A7J0E2G6 | 1-121 | MRYAASLIGGPSTLATFVAVYALFGPTFPGTYDKDRGVYTLFYPGLSFAFPIPSQFTDCCHDGEAELPLEFPDGTTPVTCRVSIYDS… |
| A0A3Q7F4X4 | 11-152 | None |
| A0A455ABE6 | 104-186 | None |
| A0A1Y3ESB2 | 608-717 | None |
| E2REW8 | 178-279 | None |
| A0A1Y1XKU3 | 81-190 | None |
| A0A1B0AYA4 | 377-472 | None |
| F4QB45 | 193-308 | None |
| A0A7S2RB91 | 100-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.