DPCstruct | MC3837
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 122 ± 12 aa |
| Standard deviation of domain lengths | 12.32 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 76.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 33.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0181 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C9SWB4 | 3-121 | NEFSRIDLTCSAESLIPSGPGYDDINHQVCTLAGSTPGTTLVDGSQYIAQGFSYFKGDMWRNFGIIVALIVGFLILNVLLGEIVNFG… |
| A0A166R5Q5 | 220-320 | TNQFRTLNSVCSNFVPMGPGYESVGLANQVCTTVGAVAGEAVVNGARFVELSYGYSYVNAWRNYGIVVAFGVAFLVAYIFFTEFDTS… |
| A0A4U0VJG7 | 1-119 | None |
| A0A177VB58 | 138-288 | None |
| A0A842Z4E7 | 13-133 | None |
| A0A842YST5 | 5-130 | None |
| R8B989 | 12-116 | None |
| A0A5M9JHA5 | 431-551 | None |
| K2RVM2 | 10-120 | None |
| A0A4Q2V6H8 | 350-465 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.