DPCstruct | MC38369
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 62 ± 2 aa |
| Standard deviation of domain lengths | 2.27 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 89.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 54.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A852W6V9 | 29-88 | LDAVHLAWAGPLEDGAPNYYRVQGPRLLIEWDNTQRDANHAHSVWRDPSADFGLDVLGAH |
| A0A7Y3FPT4 | 457-518 | AGIDEITFGWAGGLERGQPHYYRLQGPTFLIEYDNTQNGANHIHSVWRDFDGDFGRDLLREH |
| A0A7Z9GWX4 | 43-101 | None |
| A0A6I5NQ00 | 16-77 | None |
| A0A800ETL1 | 119-183 | None |
| A0A7V3UPK3 | 103-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.