DPCstruct | MC38367
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 70 ± 12 aa |
| Standard deviation of domain lengths | 12.25 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 88.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 36.39 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | CL0036- PF02310 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C2XYR2 | 1-66 | MSALLTTTMGYMKVVIDKIKAEGMPVKTMVGGAPISPAFAEKIGADAFAKNATEAVEKAKALLGIE |
| C0QAB4 | 2-50 | MKKTVDAIVESGLRDHVKIMVGGAPVTQAYADEIGADGFAPDAGSAAKL |
| A0A846NSM6 | 40-112 | None |
| A0A1I5J0N5 | 869-937 | None |
| A0A3L7WJM2 | 569-666 | None |
| A0A2E7Z193 | 27-72 | None |
| X1PYG3 | 1-66 | None |
| A0A843E344 | 11-84 | None |
| A0A3M1GQE1 | 577-650 | None |
| A0A7X7BNS6 | 5-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.