DPCstruct | MC38366
Metacluster Properties and Pfam Annotations
| Number of structural domains | 69 |
|---|---|
| Mean domain length (aa) | 94 ± 20 aa |
| Standard deviation of domain lengths | 19.53 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 91.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 29.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C2XSJ8 | 7-101 | TAKFAKLFDHSIVRPDATKEEVRQFAETAVKLKTATLTVQPHYIRFAAELLKQSEVQLGTVVGFPHGNETNENIFNSYRGGNSHDKP… |
| A0A1F8L5F0 | 3-75 | DHTLLKADATPDQIAQLCYEARKYGFASVCINPTWVPLCAKLLEGSDVKVCTVIGFPLGATAPDVKVFETQNA |
| A0A355UZ58 | 43-134 | None |
| A0A656H381 | 7-105 | None |
| A0A829WJW3 | 8-109 | None |
| A0A7S1MIT1 | 434-511 | None |
| A0A284RBR4 | 135-217 | None |
| A0A7X8Q5T4 | 3-85 | None |
| A0A5F5XS33 | 47-159 | None |
| A0A1W0A3K6 | 109-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.