DPCstruct | MC38363
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 386 ± 75 aa |
| Standard deviation of domain lengths | 74.88 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 79.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.31 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 25.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0317 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M1PL88 | 4-251 | FPLLGMHKNVACEKCHTSGKFKKPLRFANCSDCHRDVHRGQFVDRADRGRCDSCHDVFGFTPAKFGIEEHASTAYPLTGAHLAVPCV… |
| A0A7C2TTA5 | 62-456 | TDCAYAQIATTNNPHGKIKMACNACHTTKGWSPLRLDLKFKHEQTGFALEGQHAALACKQCHASLKFTGASKECRECHKDVHDGTLG… |
| A0A2E1VPV6 | 133-542 | None |
| Q605T7 | 108-556 | None |
| A0A0S8FMW5 | 145-471 | None |
| A0A2E5HL46 | 68-398 | None |
| A0A7X7U4Y2 | 28-460 | None |
| A0A7Y5IH44 | 14-269 | None |
| A0A3A4PCL6 | 127-492 | None |
| A0A845U0B6 | 71-528 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.