DPCstruct | MC38361
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 169 ± 15 aa |
| Standard deviation of domain lengths | 14.53 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 36.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C2NBZ6 | 1-172 | MLGRVGAWWGVIGVSLLIGWAVVRLSPIAAEAWAMSWGWMEWALAVPWLLFMLVGEGYRGFQKGFAPRVAARARYLREHPTTLRVAL… |
| A0A349LJC6 | 2-154 | DRLITAWALAGVGSTLVIAVVRLSSRGWETVINGLSPIEWVVLALTSTVFFYGEGVMALERRWVPHVVNRSRELRRKSGAAVRIGAP… |
| A0A7S3XHZ7 | 72-240 | None |
| A0A812RA72 | 950-1097 | None |
| A0A7S3MHY7 | 102-262 | None |
| A0A7S4A613 | 1-189 | None |
| K0TQL4 | 506-704 | None |
| R1D6Y6 | 51-219 | None |
| A0A1Q9DNA9 | 115-278 | None |
| A0A850BGX5 | 13-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.