DPCstruct | MC3836
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 189 ± 26 aa |
| Standard deviation of domain lengths | 25.53 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 42.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A369JZN4 | 172-343 | AVRGNNWRSFNNWGGHASLGNFDNFHGIDNFDGSHFSQVVVKQERELVCRTQRVEIIQQQLIILQEMAKRIVTEQICEVETQTIVFE… |
| A0A0W0F367 | 1-206 | MLSSFILSALFLATSAFAGPIAPPVAQDIVNSQPISFNNYNNILSLNGFDDFRGVDNFDGSRNAQVVVVQEQQQVCRTQQIAVVQQR… |
| A0A0B7FF03 | 4-239 | None |
| A0A0C9UHE4 | 1-152 | None |
| A0A4S8ML64 | 1-157 | None |
| A0A146IPL3 | 1-206 | None |
| V2XD74 | 80-253 | None |
| A0A0C3BT58 | 1-217 | None |
| A0A165EKY8 | 65-285 | None |
| A8NUN9 | 31-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.