DPCstruct | MC38353
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 56 ± 12 aa |
| Standard deviation of domain lengths | 11.74 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 90.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 53.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R7ASF8 | 3-50 | PEEMSMFPVGEPNDAYAKYFVGQSYLNMLSTEQVVVGNVTFEPGCRNN |
| A0A0K9CPQ3 | 3-45 | IFPVGKPNDAYAKYFIGQSYTAPVVTDGVPVVNVTFEPGCRNN |
| A0A509D3L3 | 5-61 | None |
| C8ZXC5 | 32-78 | None |
| R5LP70 | 15-69 | None |
| A0A1C6HYP9 | 5-54 | None |
| D5HHJ8 | 124-173 | None |
| A0A0R1SDE7 | 3-62 | None |
| A0A173W666 | 1-49 | None |
| A0A6L6H766 | 1-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.