DPCstruct | MC38351
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 176 ± 7 aa |
| Standard deviation of domain lengths | 7.02 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 87.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 34.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A136M120 | 145-321 | MYESLTKDSDFVIHSSNKVANISDDIKFWTGEDVEKPLTTKAIFQSSDAHSLDQIGKKFTWVKGDSCFETLRQAVVDYKNRVLIQDR… |
| A0A3A5QXM7 | 203-385 | RKYFYQVANMFFATNRGTIDFGLGKKHATLEDYLNEFKTLKPCICGSDAHSLDSLCVFPNGLSCWIKAEPTFEGLMQVLYEPEERVK… |
| A0A1C1Z6H8 | 204-386 | None |
| A0A7J0B4H7 | 3-183 | None |
| T1UAN2 | 106-271 | None |
| E6NLE4 | 179-343 | None |
| A0A3E4I2P7 | 116-296 | None |
| A0A238GX16 | 179-342 | None |
| A0A410NAU4 | 190-369 | None |
| A0A7Z0MNQ5 | 1-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.