DPCstruct | MC3835
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 183 ± 21 aa |
| Standard deviation of domain lengths | 20.68 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 41.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0W0F193 | 1-209 | MLPHLQNVLRTIPPSVAMPVFTGHWSAIIWADTRPSDVEFRLESPLAFWQSLGWFISGAPQPTVARKRPVLHHPEGIRLLSFHQHWL… |
| V2XQR4 | 1-200 | MLPHLQNVLGTISPSVAMSAVLGDWRLTMWGDIQKSDVERWLYDPRAVWDSLDWYIRLAPWPNLRDPTLLHSEGVRLLYFHQCWQEL… |
| A0A0W0FJD2 | 1-200 | None |
| A0A0W0FPD6 | 1-140 | None |
| A0A0W0FX53 | 32-203 | None |
| A0A0W0GAV4 | 8-177 | None |
| E2LGP0 | 7-194 | None |
| E2LPS8 | 1-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.