DPCstruct | MC38348
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 49 ± 7 aa |
| Standard deviation of domain lengths | 7.07 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 66.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 87.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0361 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U3MZZ9 | 1-56 | PDAEVIALSPKTLMATNRFVCEVCNKGFQREQNLQLHRRGHNLPWKLRQKSTKEVK |
| A0A7J7FY15 | 1-37 | MATNRFLCEICNKGFQRDQNLQLHRRGHNLPWKLKQR |
| A0A833V8L2 | 11-62 | None |
| A0A2I0KK39 | 1-38 | None |
| A0A498IJF2 | 77-133 | None |
| A0A7J8MRM3 | 44-97 | None |
| A0A445IH88 | 9-63 | None |
| A0A5P1F3W5 | 1-42 | None |
| A0A6A6NB41 | 1-42 | None |
| A0A7J6GUA2 | 48-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.