DPCstruct | MC38343
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 79 ± 5 aa |
| Standard deviation of domain lengths | 5.00 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 74.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 64.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C1E4H5 | 246-317 | GNTVAVKGECPSCAEEVYAFLPGNRAVARVECECHVCERRLAFRVEVAKSENAKWRRVATGRIYLVGGGDGG |
| A0A151TMC7 | 1-89 | MNVPVKVLQGLWRNDLVALKGACPNCGEEVFAFVRMDRNIDSPHRANCHVCECSLEFRTKVEQSVSRFGRQWVYGRIYLVSLRGRSL… |
| A0A452XMD3 | 160-239 | None |
| A0A0A9EU16 | 1-73 | None |
| A0A445I1F9 | 140-218 | None |
| A0A803LCH1 | 220-292 | None |
| A0A396I8A2 | 336-421 | None |
| A0A0R0HU24 | 125-204 | None |
| A0A804LAV0 | 176-249 | None |
| A0A445GNX7 | 82-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.