DPCstruct | MC3834
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 143 ± 14 aa |
| Standard deviation of domain lengths | 13.91 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 42.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y9YZ11 | 9-138 | SLLSLPEDVLLTLPHYLRDIEDFINLAATCRLLHNLSLHTLPRTILRLAAAASRTFFRPDPCFLVAATARQVGEWASRSSENTAELR… |
| A0A0W0F0I8 | 1-145 | MHMQLLDLPFEVLCSLPLYIRNIEDFNEASSTCSILYRAFSTATPNTILRLAAASSPTFFTPHLLIAATARQVSDWALQSSSNTEAL… |
| A0A1L9RBQ7 | 2-135 | None |
| B8NPT3 | 3-129 | None |
| A0A1L7WYL9 | 1-144 | None |
| A0A6A6BMF4 | 8-152 | None |
| A0A1C7MQU6 | 1-145 | None |
| A0A6A5UXD7 | 2-157 | None |
| W2RQX2 | 5-134 | None |
| A0A084BCE4 | 3-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.