DPCstruct | MC38337
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 85 ± 10 aa |
| Standard deviation of domain lengths | 10.21 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 73.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 34.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0001 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G9KJM3 | 5-79 | YNRINTFIVYLMVTFSLISIISITECTPNHDPCPPQYAEALCLNGGTCFSVTIMGSDNYNCICAPGFRGWRCQEK |
| A0A6V7U4D1 | 1-104 | MLKKYFLFLILIFYLIKIKALPPPIPPPTPPPELNNSTKNSTAAIDTITLTRPCPESYSKYCYNRGKCYAAWTGKGNYKPFCHCARG… |
| A0A3Q3B5F7 | 1-84 | None |
| A0A7J6YTX2 | 33-123 | None |
| A0A7R9QAL1 | 84-172 | None |
| T1PAX9 | 107-176 | None |
| A0A669BUL9 | 3-103 | None |
| A0A3S3Q2X9 | 13-87 | None |
| A0A1B6IBZ4 | 4-93 | None |
| A0A443QHG8 | 1-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.